DPCstruct | MC29742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 134 ± 21 aa |
| Standard deviation of domain lengths | 21.29 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.61 |
| Pfam Score | 87.44 |
| Assigned Pfam label(s) | CL0105- PF02906- PF02256 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4SZQ7 | 293-450 | GNTGGVMEAAIRSAYYFITKQQPDENLLKLEAVRGLDGVREASVTIDNLSLRVAIVHGTDNARKFLAHMEETKQHYDFVEVMTCPGG… |
| A0A7S4H913 | 26-156 | VRNSDFHELVLFDQRDNKTPLLKFARCYGFRNIQNIIRQIKSSKGCAYHYIEVMACPSGCVNGGGQIRPDESTKEAPKERLLRVQET… |
| T0CLG3 | 28-150 | None |
| A0A7X7IG58 | 354-475 | None |
| A0A0A0LVS1 | 472-606 | None |
| H6SPT8 | 670-812 | None |
| A0A645J4J0 | 2-91 | None |
| A0A1I0BL16 | 437-583 | None |
| A0A2C6A0K3 | 229-370 | None |
| A0A3C1S561 | 8-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.