DPCstruct | MC2974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 55 ± 3 aa |
| Standard deviation of domain lengths | 2.64 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 75.48 |
| Pfam Score | 60.71 |
| Assigned Pfam label(s) | PF00623- PF04997 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A0HSR2 | 72-128 | EKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG |
| A0A6A4QAT7 | 1-53 | MCQEKLVQEFLDTLLDNGICGQPMRDGHNMVYKSFSDLIEGKEGRFRETLLGK |
| A0A803MIM7 | 1-53 | None |
| A0A699GPC9 | 190-246 | None |
| A0A803M6L0 | 738-790 | None |
| A0A4Y7ICD5 | 968-1019 | None |
| A0A6A4PHM1 | 1-59 | None |
| A0A3Q7EC61 | 1-53 | None |
| A0A811R5L9 | 1-53 | None |
| A0A3S4X8W8 | 116-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.