DPCstruct | MC29737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 163 ± 16 aa |
| Standard deviation of domain lengths | 15.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8QRF5 | 1-156 | MCRNQTLNRAIEDLYENFILSGHVNGHSQEIKIRQCNMWKINKDLMLSYSIAAFMASLCIIVSISSCISNGVIHSTAFSALVATTCN… |
| A0A162X8R4 | 218-375 | QQNLMEAVQNLFEDILLTLLSELNLVAAETQAVKCVKSRTMIVHIYLPSSLWIGYAMAVAITLASILVGSRAIYQNGVASDTLFSRI… |
| A0A4Q4Q5B7 | 127-287 | None |
| A0A2C6AHS6 | 1-198 | None |
| A0A7D8ULQ6 | 161-312 | None |
| A0A428TMU5 | 88-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.