DPCstruct | MC29734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 209 ± 24 aa |
| Standard deviation of domain lengths | 23.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5JLU7 | 212-422 | QNIWSPRPIFQSYSVFSQGLAEDNKKHLQGKHKPDNIIFKIEPIDQRIPSLEDGASWPLLLTYYQPGHSANNFLLLHKNDNPYQTNL… |
| A0A1Z9J5H1 | 41-246 | PEYVILNRKVIDQRWPSIGLEGPALSEISRNYELAGQGSKGSLVMKERSQPQPSKEIIIFEETFDLSQQRSTSRPLALPNNLPAGSS… |
| A0A2W5S918 | 305-551 | None |
| A0A1X2BWG2 | 19-207 | None |
| A0A2V8K327 | 161-385 | None |
| A0A4R0WRH6 | 1-163 | None |
| A0A6M0A201 | 433-681 | None |
| A0A1U9VIA1 | 24-187 | None |
| A0A0S4UC66 | 186-399 | None |
| M5JTP9 | 444-661 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.