DPCstruct | MC29731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 212 ± 22 aa |
| Standard deviation of domain lengths | 22.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4TS32 | 9-218 | WLVLLLCLISLRDVEAQFPRACTTPEALQTRMCCPLWNGSTCGFSSGRGVCAPHPARDLPKPEDYRVNWPRVFYDSVCTCWGNYDGF… |
| A0A821SB08 | 18-195 | ILVVHAQFPRACTTVEAIVSKRCCPLLGSDPGNVCGVLQGRGRCAPVVVDEHPWSGPYVLRNVDDRERWPLKFYNATCQCTGNFAGY… |
| A0A183TFI9 | 1-198 | None |
| A0A672KL58 | 4-235 | None |
| A0A448XB79 | 29-243 | None |
| A0A4Z2E317 | 2-216 | None |
| A0A1I8IJ91 | 2-197 | None |
| A0A654H7D9 | 451-720 | None |
| A0A665VJ38 | 2-219 | None |
| A0A183VMI2 | 4-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.