DPCstruct | MC29725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 116 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 69.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9S340 | 1-109 | MASISGMPATATIPVSKPRPWRPSPPRLGGGGGNGGLVVECSSRPKKKATAHHMKTRPKKTQPWDIRRKGPTIYPPLPPLPPDWTLV… |
| A0A6P6B6C5 | 1-107 | MPIISITSATKITFLPNSIPSVPSFKTKSNGGLVVECSSRPQKKATKHHMKTRPRKTQPWDIRRKPTVYAPLPPLPPDWTLVSSGDS… |
| A0A834LHN6 | 1-118 | None |
| A0A059BJJ8 | 47-156 | None |
| A0A6P3Z3E9 | 1-119 | None |
| N1R283 | 61-193 | None |
| A0A835U3Y9 | 1-120 | None |
| A0A6A2YYZ0 | 7-130 | None |
| A0A2I0IU81 | 1-119 | None |
| M5WRK4 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.