DPCstruct | MC29724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 450 ± 54 aa |
| Standard deviation of domain lengths | 54.31 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M8MSE0 | 2-462 | PTTFASTPVANFTQVTRTGAIVKETCYQLPQPSTGSTRRALLHNEALREQNATIPFPYIESVDFHTDGIEPLYLTLRDAAEGTHFID… |
| A0A6G1P5T8 | 56-527 | AAATYAPDRLISATRNTYAARPRTFTGVSVTGDLDATGCYAVPTPTGSLRESRLNNTDRNPPYVEAMYFDQNATQAKYVRVMDQALN… |
| A0A3M9YJQ1 | 47-470 | None |
| A0A420YJY7 | 34-428 | None |
| A0A2N6NYE6 | 31-533 | None |
| A0A428UDF0 | 589-1077 | None |
| A0A0A1TCN8 | 84-554 | None |
| A0A194X949 | 3-359 | None |
| A0A162JQ48 | 2-341 | None |
| A0A7D5YYL8 | 306-806 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.