DPCstruct | MC29722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 195 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 33.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1NW31 | 1-219 | MEMRHGEKKAATVARHTDQTEKMEERHAKTASHLDERQIEAEMELRMTLQQSENSVKIRLKHMEAYCEGLGHGLDSELPKRVVTERD… |
| A0A6H0XUS3 | 288-481 | KQQRTAMLKILQEHHAKALDDQAETQSHDMLVAEDRQVKAEADLRNMQDQEIRDNATRLRHMEAYCAGKLASGDSHNRVITEQDLLE… |
| A0A4U0XFG3 | 586-782 | None |
| A0A2V1DSI5 | 2-186 | None |
| A0A175W6B4 | 1451-1656 | None |
| R1GJB9 | 145-321 | None |
| M1WF29 | 150-367 | None |
| A0A395J3G0 | 2-185 | None |
| A0A6A6YAV8 | 372-555 | None |
| A0A4T0DTZ2 | 170-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.