DPCstruct | MC29721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 191 ± 38 aa |
| Standard deviation of domain lengths | 38.45 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820KB66 | 7-159 | LCSVSASFDAIIDLPPSSADGGKQRKPVLAQLILKVHEKCEQNGAQSNTIQLIDLEQIPLAYHPGEHTHRVQLTAIGQLDLNKFKRN… |
| A0A2S7PB47 | 401-637 | KVAGEIDLIEILDGKDERDVVKSASKVAIDTAIARGADSENVRVVAIEKIPLQYVSNKATRIKVKAIGKLQAPETGILEGSTMMFDE… |
| A0A0U5FQL5 | 438-676 | None |
| A0A395J972 | 223-380 | None |
| A0A0L0MWS3 | 175-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.