DPCstruct | MC29720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 209 ± 23 aa |
| Standard deviation of domain lengths | 23.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 16.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12081 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4FXC4 | 13-185 | EVLDASKKINISLEKANIESQSVNDATLQIAIKEYPLYSTQLIQVSKASEQLRLVIDSLKSNGLELSENYQEMNGSKYYDTLFFEGD… |
| A0A5C6YVZ5 | 2-210 | KKNLFYLIAITLIACTEKQKSDSDFEKDFGMYTVLLNDIDYHAFYIEKQIEFELSNLNTPDSELQTVDSITKLYIANIDKILTEFQS… |
| A0A090Q4L0 | 1-201 | None |
| A0A1Q3GF89 | 11-188 | None |
| A0A7Z6WVQ8 | 14-226 | None |
| A0A7V4JNH3 | 3-226 | None |
| A0A7Y4WY26 | 45-224 | None |
| A0A1F3KL41 | 143-384 | None |
| A0A4R6SWY4 | 3-205 | None |
| A0A800AWQ0 | 5-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.