DPCstruct | MC2972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 150 ± 24 aa |
| Standard deviation of domain lengths | 23.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2GGQ2 | 5-190 | TCNGYSILRAIPVTTSEADVAKALDLVKKTRLYPLDQAENPPPQRHIDMAGKLFDGIVRFDDSVYDSLARIINDEPVQPHDLVAMGQ… |
| A0A2R8C761 | 192-373 | RLMPEDRDARMALLDQIEVYPWSERDTPKTLDVITPDGRPWMAAAPLGMEYWELLNDTIQREPVHERDRFIMAMLKPLGIEKGKPFK… |
| A0A5C6A408 | 2-161 | None |
| A0A1S9D163 | 158-290 | None |
| A0A1E7IYH1 | 2-156 | None |
| A0A2U3B0T9 | 65-261 | None |
| A0A1Q9C4C2 | 711-833 | None |
| A0A554PAN7 | 257-381 | None |
| A0A7V1K312 | 2-154 | None |
| A0A5K7Z1P7 | 230-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.