DPCstruct | MC29714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 128 ± 13 aa |
| Standard deviation of domain lengths | 13.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6K6U7 | 515-631 | LLPEDLPKVYAHEVGHVIDQAAGEIPVKGLEDELGNLYHTLNAPERAGEFPAPGQPRFTPERHGYDGDDPPRELMTEAIRAYMADPA… |
| A0A2N5APH9 | 8-172 | EIQFFFATNKKLFARCPCRQELSHLHEFDEVSAHHVLCHMLGHFLDLKTGQPALNDSNEIISAIDQDGLDDELRYVYNDLQNPELNA… |
| W6K6U0 | 159-267 | None |
| A0A5C5TBG2 | 269-394 | None |
| A0A858WV44 | 1-128 | None |
| A0A1I3S9L6 | 184-318 | None |
| A0A1G7CUD0 | 124-245 | None |
| A0A1I3EYG2 | 94-222 | None |
| A0A7W6WBR1 | 38-155 | None |
| A5VES5 | 311-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.