DPCstruct | MC29713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 159 ± 23 aa |
| Standard deviation of domain lengths | 22.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.24 |
| Pfam Score | 95.74 |
| Assigned Pfam label(s) | PF10150- PF20833 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1ZDI2 | 134-258 | RDFDKAGWDELVEQAQSGEVDFPGGRLTFSPTPAMTLIDVDGTLPLRDLALASARAIAQNLARLDIAGSVGIDFPTIEGRTDRQAVD… |
| A0A2Z5QZS6 | 281-434 | ISQYIDEVSPDLSERLEHWVGPEDVFAAHRVDEQLAKGFDRKVWLPSGGTLVIDRTEAMTVIDVNTGRFTGAGGTLEETVTRNNLEA… |
| A0A022S118 | 386-561 | None |
| A0A7W1YDV3 | 322-496 | None |
| A0A162ISK9 | 201-353 | None |
| A0A832EYJ2 | 49-217 | None |
| A0A7C2N811 | 2-135 | None |
| A0A4P6EPD1 | 62-235 | None |
| A0A7X6ZT36 | 30-181 | None |
| A0A521GZJ6 | 222-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.