DPCstruct | MC29711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 126 ± 20 aa |
| Standard deviation of domain lengths | 19.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF14789- PF14790 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3VKF5 | 2-114 | TTLQRTGHRYRDTETGKTIDVWFPQTGAQLKRGCLAEKVGLIAGDFVDVTIESFDAPPVSTEDAYLRLHLLSERTVQPNAINLDGIF… |
| A0A2Z5QVV9 | 1-120 | MTDDGNTLDVWYPRPVLGDEPENGHADLLASLSAMERRDEARGVHTTVVRTWADLDDAPQTVAGAYLRLHTLSHRLVKPNTVNLDGI… |
| A0A0K2RR09 | 31-138 | None |
| A0A2E8XIW9 | 4-178 | None |
| A0A0F9W3H9 | 1-135 | None |
| A0A160NWL1 | 247-397 | None |
| A0A087BMY2 | 128-258 | None |
| A0A5Q2VY24 | 56-164 | None |
| A0A8A7XZ82 | 1-100 | None |
| A0A4R3Q4S5 | 2-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.