DPCstruct | MC29710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 458 ± 61 aa |
| Standard deviation of domain lengths | 61.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19877 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5QRN6 | 2-436 | QPGQAAQPSPLAQTFTAWFRGPGLTSTALSLAIVLGSAAISAILTLVAMSTMDSTKMFPTTFSTLPLLMGWSLGGQFVMSGSNSYET… |
| A0A7G9RDR1 | 8-402 | PRTASTPGGEPVRRPLWLSAGLAGATAAGAVLVGCMALALVGWFASDAGAHGDTRDALRVGAVAWLLGHGSGLALGAATISLVPLGL… |
| A0A2P7PH40 | 2-416 | None |
| A0A7X1M2R0 | 1-543 | None |
| A0A401ZUW7 | 120-652 | None |
| A0A087C117 | 40-579 | None |
| A0A2M9KZI2 | 40-468 | None |
| A0A430FDV8 | 169-763 | None |
| A0A3G6IV76 | 2-420 | None |
| A0A0N0GYS5 | 14-523 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.