DPCstruct | MC2971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 4.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 46.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00719 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836AFD5 | 64-143 | EFKDKNLAIDIIESTHDYWRALVIKKTDGKGISCMNTTVSESPFQCDPDASKAIVDTLPPPCESACTIPTDVDEWFHHQK |
| A0A6I9XKA8 | 1-83 | MVKQKQREFALHIIDEVHQHWQNLVKQEDSSGEIECSNVTVEGSPFKITTEAAEEILEKAPESMGPQPIEPIVDKCYFMHPKL |
| A0A2Y9RN00 | 187-262 | None |
| A0A643BMB5 | 112-191 | None |
| A0A5F4WEB4 | 91-167 | None |
| A0A833RLI0 | 846-914 | None |
| A0A7J8DQN1 | 44-123 | None |
| A0A2K6FA25 | 159-232 | None |
| A0A0E9X7H9 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.