DPCstruct | MC29707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 341 ± 27 aa |
| Standard deviation of domain lengths | 26.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0K9K9 | 2-316 | SWMADYSIKFDGCHSIVQYAEEGGGGEEAMSKTRRQHLARYKMCKSDACNTNCKGEYLVDLGIFVDAYTEFTMELQEYQCEQVRENC… |
| A0A7S1G246 | 1-353 | MLKSLAIATFFLARAYALRSNSSTFKALLPKARRLDNDDGIDYTYVADYSIKFQGCHHVSQWNNDADGDDNVLIQTKRLVRFRLCPT… |
| A0A1E7FSE7 | 493-820 | None |
| A0A1E7EP86 | 23-373 | None |
| A0A7S2I5L7 | 1-333 | None |
| A0A7S4EJZ6 | 1-312 | None |
| A0A1Z5JAM3 | 1-329 | None |
| K0TDC4 | 60-468 | None |
| A0A7S4QW99 | 2-354 | None |
| A0A7S2K1W5 | 12-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.