DPCstruct | MC29704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 130 ± 22 aa |
| Standard deviation of domain lengths | 21.52 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8VIP7 | 2-116 | QKVLHFLKNDPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLNRTGREEWARQFRESAKEKDDSALLKIMSNYGEEVVTALG… |
| A0A7S1FR75 | 8-111 | SILLQRRSIEGVSSVQSQWTGPYAFSYKAEVDFDGTYLAARLMSRYKKEFRKATEGSSLDKDLSVLLSWYAEDVMRLVEREVRDIEA… |
| A0A1Y1L3F8 | 56-179 | None |
| A0A183LL19 | 99-240 | None |
| A0A6A5DHG8 | 495-639 | None |
| A0A6P6QU15 | 992-1128 | None |
| A0A7S1GU49 | 28-136 | None |
| A0A183KLH2 | 75-167 | None |
| S9WBT8 | 498-635 | None |
| Q22GF4 | 312-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.