DPCstruct | MC29703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 287 ± 28 aa |
| Standard deviation of domain lengths | 28.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6U2BHY8 | 32-320 | LVGPHHPGKVFFKNAKQLGQHQPCTLTLANFPGWALVPKSDPKVIKHEGRDFDLLQVGFAQASEDNAVEAILDSQGFVTVDDGWYLD… |
| A0A7S1FNV9 | 13-274 | PSKLSLELSSHPGKGIIHTIDFLKSLSSAKLHNISFAGIGPKEASACVIREGNRLRCTDSGDFLSFLHNAQEGAMIVWNGSEESEKQ… |
| A0A7S2F8L7 | 56-350 | None |
| A0A7S0C597 | 3-230 | None |
| R1DJX7 | 43-301 | None |
| A0A7S2H6M5 | 126-381 | None |
| A0A7S2VWJ4 | 15-317 | None |
| A0A7S1FSS4 | 2-291 | None |
| A0A7S2LGP9 | 156-475 | None |
| A0A7S1BLD5 | 691-1022 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.