DPCstruct | MC29701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Standard deviation of domain lengths | 13.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 53.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1C278 | 3-111 | AAPSDLSSSRHVTVITTASLPWMTGTAVNPPPRAAHLLRRQLRSPPSSSAGVRLVAPWLEDPRDRRRLYGAPGFSDRCAQEAHLRAW… |
| A0A7S4UW81 | 267-387 | DKSKNIWIVTTAALPWMTGTAVNPLLRAAYMTIGRKAAGGSVTLMLPWVEKRSDQERVYGKDRIFENEEQQEEFIRNWLRNTANMKD… |
| A0A7G2EWA5 | 5-106 | None |
| Q0JDA6 | 34-165 | None |
| A0A835AI94 | 276-413 | None |
| A0A251SS50 | 254-356 | None |
| A0A4S4CXU2 | 3-113 | None |
| A0A7S1V6P2 | 1-102 | None |
| A0A482S6D6 | 59-176 | None |
| A0A426YYD0 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.