DPCstruct | MC2970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 163 ± 38 aa |
| Standard deviation of domain lengths | 38.15 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151IQM3 | 5-134 | NSHKIVLAASHAARKSGNNDMSTCLNILSSSPERPKKIRKILESKINITKKSAEEGLAFLLHNNLSKQLYINMRLECKISGADIWPS… |
| A0A6I9X9T0 | 27-163 | RIKRRKATDLRNSRSISELLLIIEMSLRSSGAFIAASIIKEITSTTPTRADKYRTALKLSTILAIIEMSDDAALSDVVEGKLSKNQY… |
| A0A4C1TXW6 | 101-215 | None |
| A0A2W1BKZ9 | 43-223 | None |
| A0A2W1BK67 | 78-304 | None |
| A0A2W1BF04 | 100-283 | None |
| A0A4Y2URE7 | 7-156 | None |
| A0A4C1ZI63 | 96-277 | None |
| A0A4C1TEK5 | 3-145 | None |
| A0A4C1Y347 | 34-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.