DPCstruct | MC29693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 174 |
|---|---|
| Mean domain length (aa) | 244 ± 78 aa |
| Standard deviation of domain lengths | 78.03 |
| Length coefficient of variation | 0.32 |
| Mean AlphaFold2 pLDDT confidence score | 78.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.46 |
| Pfam Score | 86.65 |
| Assigned Pfam label(s) | CL0561- CL0229- PF10607- CL0172- CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0HU01 | 1-126 | MKRPADCLEDMEKRKRIFRFALEGNALKAIELTQELAQDLLEKNPDLHFDLLSLHFVELICSRKCTEALEFAQSKLAPFGKVQKYVA… |
| A0A2H5NGP7 | 6-281 | IKDAFDRVAKKQKLSCSKTQEVIDLIVQEIEKALETVKSASHLDDKYVLTELKRRLQEIAPLGQLEGTQKELNIALSKYTKILEKSF… |
| A0A835JD04 | 428-749 | None |
| M9MCG4 | 2-441 | None |
| A0A7I8KXA9 | 5-246 | None |
| A0A7S4NQ20 | 26-276 | None |
| R9P3L5 | 651-1062 | None |
| A0A1R3KC56 | 5-187 | None |
| A0A022QL47 | 7-171 | None |
| A0A7R8ZZY0 | 156-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.