DPCstruct | MC29692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 167 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8MCQ6 | 25-183 | QEETSPSSLGAVVRRVPGEPSPLPQKQPSGISRSEQLLGLQRYLNFPFVPAYVGKDGGVVLDRVVHTLGSRGSSWWATITARLRAQR… |
| A0A2H5N400 | 1-161 | MKKLRWAMEGEFWELDQSTPKSLEGSARAVPGNPNPLGISRGTRLSRPKQIDFMQRFMATPFLPSFSAGTLQLQRVLPFQFSGDWFA… |
| A0A835JRF9 | 3-167 | None |
| A0A7J6VKF1 | 114-288 | None |
| A0A5N5FD99 | 651-819 | None |
| A0A068ULG6 | 1-178 | None |
| M0ZN40 | 1-176 | None |
| A0A1D6MPH5 | 16-169 | None |
| A0A1R3G5M4 | 293-456 | None |
| A0A2U1PB68 | 1-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.