DPCstruct | MC29690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 261 ± 51 aa |
| Standard deviation of domain lengths | 50.91 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8RF16 | 13-234 | LTVLIFVSLVPVSVLGDEGMFLPDTLSQLPLKKLQQRGLKIPITDIYNPNGPSIKDAVVIVDGGTGEFLSPEGLMLTNHHVAFDALV… |
| A0A7Z9Q0P4 | 3-172 | TEPWMDHLRLSSVRFNNGGSGSFVSDQGLVLTNHHVGADAIQKLSTEGSDLIKTGFLARSRDQELPTKDLELNVLYDIVDVTDKVKG… |
| A0A1G6GJL6 | 33-190 | None |
| A0A1W9T9A2 | 7-332 | None |
| A0A3G8M0L0 | 4-281 | None |
| A0A538QRN1 | 71-380 | None |
| A0A848QF67 | 1-226 | None |
| A0A2T2SJ87 | 72-311 | None |
| A0A0M3C3H2 | 16-286 | None |
| A0A7X6V5X1 | 7-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.