DPCstruct | MC29689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846U493 | 18-103 | IPDTDPVFDYCQTVGIDRDILLLHWREFKTRRAEGKRQRDWRQTFRNSVRDNWFRLWFLKPGEGAQLTTQGLQALAVMQREQSQQA |
| A0A7V8FKF9 | 15-94 | FEFADDAGIPGDLLALAWDWFCGTYGAGGARSTKTQANWRQVFRNAVAGNWAKVWYALPEGGYGITTVGETLRRAAAAKA |
| A0A6L9PW32 | 185-268 | None |
| A0A2P8KK79 | 2-65 | None |
| A0A0U3K620 | 2-65 | None |
| A0A1G0HWL2 | 43-128 | None |
| A0A524BD28 | 2-73 | None |
| A0A1I4VV03 | 16-102 | None |
| A0A2D9EKZ4 | 82-174 | None |
| A0A1N6QY39 | 230-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.