DPCstruct | MC29688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 303 ± 42 aa |
| Standard deviation of domain lengths | 41.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521YZ20 | 129-371 | TGVFRAAYAAASKRMGELDLTLGYGSKRIDGAFGGLRWSPGAVPNWSLVAEYDAYDYKRDFGSALSGAGDYKKEPAVGVEYQKDWYG… |
| A0A7V8FJX1 | 4-302 | TGLFSSEYLVASKRVGRFDASLGLATGYIGNRGDFRNPLAAIDDHFETRPRAQGTGTLNSDGMFRGPVGVFGGVAYQTPWKPLQLKL… |
| A0A0C2ZQ51 | 97-397 | None |
| A0A376YIC8 | 49-328 | None |
| A0A259D372 | 1-298 | None |
| A0A3A0EVI0 | 155-399 | None |
| A0A0M4T2A8 | 186-527 | None |
| A0A0B8NN68 | 15-308 | None |
| A0A447PX65 | 331-668 | None |
| A0A6N3UB84 | 93-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.