DPCstruct | MC2968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 102 ± 5 aa |
| Standard deviation of domain lengths | 5.27 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.99 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 70.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7FDB7 | 34-130 | PGEHLRNALWHTGDTAGQVRTLWHDPKNIGWKDFTAYRWHLTHRPKTGLIRVIMYEGKRIMADSGNIYDKTYAGGRLGLYVFSQEMV… |
| A0A3Q1CYL9 | 51-150 | GPGEYLRNALWHTGNTRHQVRTLWHDPNEIGWKDYTAYRMHLIHRPKTGFIRVVVYEGREILSDSGAVYDHTLAGGRLGLFVFSQEH… |
| A0A3B4UYG0 | 1053-1165 | None |
| A0A7N8YC94 | 694-795 | None |
| A0A2U9C2F1 | 914-1014 | None |
| A0A556TPZ3 | 265-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.