DPCstruct | MC29677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 6.70 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4ZF64 | 55-149 | TEQRKLTRPEWMRLKKVNLPPLRHLRELRMSDVSGYEVGQKLLVDLFKPGDKVDITGLSKGRGFAGVVKRHGFAGGPATHGQSDRHR… |
| A0A2V9NZG7 | 1-100 | MSQPERGHLAKNNLPPMKFVREVPLEFEEKAEAPVAGNGLKAGDRVLVDIFDGEKFVDIVGISKGKGFQGVVKRHHFGGGPKSHGSM… |
| A0A6A5LEL8 | 244-341 | None |
| A0A7V4NJ67 | 2-93 | None |
| X1VIJ3 | 1-117 | None |
| A0A7J7A3X9 | 354-455 | None |
| A0A3Q0RHR6 | 143-248 | None |
| A0A4V0X9Z3 | 53-158 | None |
| A0A251VLU0 | 2-98 | None |
| A0A183CPU5 | 34-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.