DPCstruct | MC29674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 95 ± 15 aa |
| Standard deviation of domain lengths | 14.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356UMN3 | 29-113 | KSSVEEMGFAEVDHARERRQGFPEVIYGDGKTGEQVLAIMGALAEKSAGSVMATRVSAEKASFVQKKLLEAVYDEASRILYIERP |
| A0A5D3FES3 | 2-79 | EELGFARVDIGRGRRRGHPEAVYCEGKTVAEVVAIARSLVGSGAENVLATRASDETLGALRAAFPGTVVHERARLAVL |
| A0A2V8HYF6 | 32-112 | None |
| A0A1E4HLG0 | 4-84 | None |
| A0A1N7INC9 | 22-109 | None |
| A0A662X668 | 48-177 | None |
| A0A520K6L8 | 29-125 | None |
| A0A1D2UWI5 | 29-111 | None |
| A0A7Y5VB81 | 231-341 | None |
| A0A256ZX59 | 6-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.