DPCstruct | MC29671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 162 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1QAC5 | 1-173 | MSKLRYWKRILRAYLTKTPSYLDFWHERPEEGNFSAYNLSGEYYMTFSDKADYAGPRDSHGVILFDYLGDIGVRYNPLAIAQYGIAR… |
| A0A4Q6AWU7 | 55-191 | SQSYSSTGDYLNYGKTVFHRPSKTLELDDQGIPMVFQGGKFNYSAGTVAIAALAEHGRSLESKNDKQFFILAHKLLTLMSDDGALRY… |
| A0A2H5WNW9 | 15-177 | None |
| A0A132NKA6 | 1-121 | None |
| A0A2V2U691 | 23-198 | None |
| A0A6A7KBS2 | 817-979 | None |
| A0A1S9I318 | 12-173 | None |
| A0A7Y3ZFS2 | 20-172 | None |
| A0A7V0M2D4 | 7-181 | None |
| A0A814UZN6 | 1-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.