DPCstruct | MC2967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 126 ± 18 aa |
| Standard deviation of domain lengths | 17.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00829 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1MV18 | 21-118 | HRIVAKTSLTSPPWPEVKLPNPVEEAKHHAEVVQKVNEMIATGQYGRLFAVVHFASKQYKITSEDLIMMDNVLQAECGDRIRMEKVI… |
| A0A6I9X1Z3 | 1-145 | MATLFSFSRLFNYAASNYLRRVTPVAICKQYYPALRLWETPIAEYRTVKPPWMKPIPNYQTEVQEWDEEKEKICTDVTNEINDQIAM… |
| A0A6V7X5R2 | 50-190 | None |
| A0A044V6K1 | 173-277 | None |
| A0A5N5MWU5 | 12-149 | None |
| A0A7R8D455 | 6-109 | None |
| A0A6G0ZA40 | 50-164 | None |
| A9VED1 | 1-121 | None |
| G7YLC8 | 290-442 | None |
| A0A419QHZ7 | 21-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.