DPCstruct | MC29665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 408 ± 36 aa |
| Standard deviation of domain lengths | 36.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3QU00 | 1-379 | MSCDQSQTQSHTLASSHIVHTNTEKLSEDRSVYDLGWNEKLDHDAEPWIRGTHNEDIWVLVRRLNKSLYEVRSAGEIPYGGLDLTVA… |
| B8N556 | 1-412 | MSGQSFTDPLPAPTAGWDNGPSKLELKEREKQGQLEAFGPTDSHALSQIDHDEKGLAQKAGDTDEVTDVGWGHSPQGRIVAGLSNED… |
| A0A2K1QKU1 | 409-847 | None |
| A0A094ILH1 | 327-756 | None |
| A0A3D8S5L5 | 27-454 | None |
| A0A0S7DIH6 | 385-766 | None |
| A0A5N6JUY2 | 4-422 | None |
| A0A1F5L7J1 | 213-696 | None |
| A0A5M9MKT6 | 5-360 | None |
| K2S513 | 9-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.