DPCstruct | MC29664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 130 ± 9 aa |
| Standard deviation of domain lengths | 9.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8N261 | 1-138 | MDPDEIEPSPAIDLSNENGVGCAVLKAAENCAAKMLRLVMRMAYSDLAGYWFSWSRIGFATVSSFMLLLLVQAPSKDHAIRARRLVH… |
| A0A2E9XT98 | 83-192 | HPGTSEQEMSEPRSTIFQNSQSCAKLVLELVAALKANHFVNFWPSYTRYQLSYMTNFALLLFVQSPSMAVAKENKLLLDKWRITVRM… |
| A0A1L9PY79 | 518-657 | None |
| Q2U0F0 | 3-133 | None |
| A0A225B3F1 | 1064-1195 | None |
| A0A0F7ZZB9 | 108-243 | None |
| A0A5N6J473 | 202-339 | None |
| A0A5N5XF85 | 287-421 | None |
| A0A3D8RCI5 | 1080-1216 | None |
| A0A5Q4BBZ3 | 34-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.