DPCstruct | MC2966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 144 ± 30 aa |
| Standard deviation of domain lengths | 29.69 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1ZBP6 | 2-96 | RDAFAASFCLWWFGENFIDLAPYINDARSLSLPLLGGNTGATAPYGFHDWEFILKETGLIRYDHLFAGISHKIGALLILLSLIWAGY… |
| A0A1F5U007 | 5-138 | FIPVIDSVNLAFHEAGHIFFALFSVEFLTSAGGTLFQLIFPLSAVIYFHRKEQHLSSMVTLVWFGENFLNIGTYMKDALKLELPLVG… |
| A0A3D2VSD9 | 3-109 | None |
| A0A841GWB3 | 20-169 | None |
| A0A1F9S096 | 59-236 | None |
| A0A7X7SIF2 | 23-177 | None |
| A0A080LSI1 | 4-139 | None |
| A0A6L5FX84 | 16-165 | None |
| A0A523DJ97 | 27-142 | None |
| A0A2T5R556 | 75-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.