DPCstruct | MC29654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 8.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7BJH1 | 2-87 | IVITQHKGLVEYLEEKGFQADKVIPHATPEDIRGQDVVGVLPYHLAAEANTVTVVTLDPPPARGEDLSKDEVAARARGIETYVVLS |
| F0RQ73 | 1-94 | MEKIVITRHQGLLEFLREEGLLDGSERVQAHASEEDVRGKHVIGVLPLHLAALAAQVTVVEMGHLPASERGRELSAEETRRWHSGIR… |
| Q7MC39 | 77-171 | None |
| A0A3N4UQT6 | 2-107 | None |
| A0A355EKU8 | 2-99 | None |
| A0A6M5F5V9 | 93-172 | None |
| A0A857VBQ9 | 56-144 | None |
| A0A559ICY5 | 89-177 | None |
| A0A845TMU4 | 2-99 | None |
| A0A379Z702 | 4-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.