DPCstruct | MC29653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 7.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13946 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W6LG70 | 188-278 | DKGVRLKNVAENFLASREFVQTYGTAATVTNTKYVELLYQHTLGRAFDQGGLNFWVSRLDTGTNDRADLLVQFSESPENQARVSAAV… |
| A0A562SY88 | 397-481 | GDMTLKQMASAFVQSTEFEQRFGANTSDEEYINALYNNVLARDADTGGLLEWDDRLDSGAWDRAEVLIGFAESPENQALTTDLVA |
| A0A4V1TFB0 | 214-297 | None |
| A0A6N6MQG9 | 1-101 | None |
| A0A7X4HB52 | 316-409 | None |
| A0A0Q4XEX4 | 85-170 | None |
| A0A5C8S5B4 | 261-360 | None |
| A0A6I3X915 | 595-689 | None |
| Q46K65 | 1025-1093 | None |
| A0A6N9HMG4 | 820-898 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.