DPCstruct | MC29651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 17.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I4NL94 | 3-160 | IQITRSGTDLLVRTPHANTNFNARIKDMGGRWEAPAWRVDARNEALVRAALVRSYGGDGEGEPDTVSLQCHIEKDSWQSPVEVAGRI… |
| A0A6M8HYZ7 | 3-148 | AKRLDGRWRGQEIGWVFEPGRGDALRALCLRIWGVDGTPDAVTDCVELRIEADYTDIRSAVWIAHDAPVYLVGREIAASLRNGRAAR… |
| A0A662VWY7 | 4-196 | None |
| A0A7W4IEU9 | 99-264 | None |
| A0A0N0MFQ2 | 46-214 | None |
| A0A1S2VBY2 | 94-247 | None |
| A0A3R6M7G9 | 1-166 | None |
| A0A0Q0BTJ5 | 5-166 | None |
| A0A0A7G2N2 | 1-168 | None |
| A0A7Y0HSD7 | 4-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.