DPCstruct | MC2965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 206 ± 25 aa |
| Standard deviation of domain lengths | 25.31 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L5FG53 | 1-200 | MIEETDANNSLTEVSSFEELESKMTDKELLKLKFARKLAVAVSENQEMRSFLKREALEMINNDYDVFYPVVKDKSIKGSDLKSSADP… |
| A0A2M8TIM7 | 32-253 | TSPSTEGKINEKLENSKIENNAYKLASILHNAITTKDNSFLKLLQKETKKKFDGDYDFLVSNFRQGTTRSSNDIERLYQSLLVPQNI… |
| A0A6N8KUE4 | 15-220 | None |
| A0A3R6FL37 | 27-230 | None |
| A0A7X6YIT1 | 4-148 | None |
| A0A081SJ47 | 22-270 | None |
| A0A7V3VUP2 | 184-359 | None |
| A0A1T5LNN9 | 36-236 | None |
| A0A841H4S7 | 18-243 | None |
| A0A327ND21 | 31-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.