DPCstruct | MC29649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Standard deviation of domain lengths | 12.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1SJE7 | 1-103 | MTHRPVHAPQDDRPARFAAEAGAALDAALVAGLNAYDRTRALARFHRLSAETIASESPDAARAALKEIERAMRGERARRGHWSYDLN… |
| A0A7V0RL98 | 1-91 | MRDAKTGGRNRPADGDYRRLRDLPRLVALWPREAHDKSIEGALRIIAKLRQAMRAERRRGSAGHWSYDLERHLSLARALKAEVASLE… |
| A0A2W4L1N6 | 1-131 | None |
| A0A2T5V1P8 | 1-103 | None |
| A0A4R3LVR0 | 1-125 | None |
| A0A0D6JK46 | 31-145 | None |
| A0A1G6CEA5 | 6-110 | None |
| A0A3S0ET38 | 2-87 | None |
| A0A7S8HAB5 | 1-107 | None |
| A0A1H9MAE9 | 15-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.