DPCstruct | MC29648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 151 ± 22 aa |
| Standard deviation of domain lengths | 21.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06674 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9TSP2 | 100-252 | LKYLQENRESLNLCADFYDEAHSQRASEAYSLGDQKYLVKMSCSLAAYQESFEILLYAKTSAGVKVAPLSLSEFVRESNGELTRNEV… |
| A0A7V0RJG5 | 32-178 | PERVDKLHRADAECRDYDAKHMRNARVTAKLAEGKMLYLLPCYTGAYNVVYSVYVFDKRYPDELKRSVFAGFSDDLGWYGKDNLINA… |
| A0A1B3JGL5 | 5-136 | None |
| T5KDI9 | 111-269 | None |
| A0A1W6ZSQ5 | 31-172 | None |
| K9PUH3 | 115-287 | None |
| A0A4P5NN24 | 52-214 | None |
| J4V8W4 | 133-304 | None |
| V5DZH3 | 52-216 | None |
| A0A1G8BI23 | 266-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.