DPCstruct | MC29647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 4 aa |
| Standard deviation of domain lengths | 3.63 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1JJ08 | 49-128 | RQAIEERARQLLAAARKGRSWVTPRGVTRWPILINDELRGSLWENVELPSLGFGDHWQAGDSARIELTHEGRVVGMLWVR |
| A0A7C4XP09 | 20-104 | EEIPREKIEAEAKALLQKATTGAEWTSPRGVKHIQILVDKEIIGHLWEKVDLKAVEVGASWTGRWGHHVQLEKDKKVVGMIWLTR |
| A0A662VU12 | 43-117 | None |
| A0A7J2H9I7 | 40-126 | None |
| A0A7C2L7T0 | 1-83 | None |
| C9RFG1 | 31-108 | None |
| A0A832WHK0 | 10-86 | None |
| A0A7V5FEF3 | 12-90 | None |
| A0A172WJ26 | 68-149 | None |
| F0LLA7 | 18-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.