DPCstruct | MC29646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 83 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.93 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF15250- CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813N087 | 29-108 | DCKRDYCSHCDRPVNVCLCPFLPETIKLDKHIKIWIFQHPFEDKRPLRTTRILEKCLEKNNFKILKGRKFTVERFPELEK |
| B0XLM2 | 14-90 | NIPADPPTMRELCKKCERPVQVCWCSALPPKPLEPRGRIIILQHPAEEKRSLRTAPMLSVGLAPGKCLIYKALILAT |
| A0A7T9E5C3 | 2-79 | None |
| A0A3S3R8K1 | 2-87 | None |
| D0NDL1 | 5-86 | None |
| A0A1B6KI16 | 2-91 | None |
| A0A834ZLB5 | 11-71 | None |
| A0A448ZRA8 | 25-118 | None |
| A0A803YCW2 | 6-88 | None |
| A0A314Z0P8 | 2-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.