DPCstruct | MC29645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0648 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0XKX9 | 30-121 | HLLPLSTRTASYVQPCRRSDPEINKCIKNSFNYIRPYIAKGLTELKTPPLEPLRIEELAMENNAGAVRIKALFTDIVALGAGNYTVK… |
| A0A2A4JLY9 | 22-98 | SAPFIQKCKWDDSKCIKGSAQSAIPILAAGIPELGVEKLDPFYMKSLDASSNGLNLQLWDIKGTGLSGCVAKKMQRD |
| T1GD30 | 18-96 | None |
| A0A7J6YNI7 | 543-621 | None |
| A0A653DAT1 | 4-105 | None |
| A0A194PM40 | 550-627 | None |
| A0A6L5CTE9 | 5-109 | None |
| A0A139WGB8 | 8-99 | None |
| A0A139WMY1 | 441-526 | None |
| A0A194REP5 | 10-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.