DPCstruct | MC29642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 169 ± 29 aa |
| Standard deviation of domain lengths | 29.13 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 21.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7PIG5 | 15-201 | KPLQAGPIETDDIDDPKADSIEGARKKAEWAKLVEQGEEKRRDTRRKVAELRMKFKRLKEQNEKLPEHMRIDLREYEILPRIRDHLM… |
| B0XJV4 | 8-168 | VATGRPPSSPLPLRTKPLLPRSIPRLGGVAFAVATKNEILNTVAEYRKQFEAILARNQALPESQRIPMECFDLDERITADLKRELQA… |
| A0A5J4NHV4 | 317-535 | None |
| A0A183NIR9 | 48-261 | None |
| A0A182JKP7 | 8-222 | None |
| A0A1Y1L1Z0 | 41-265 | None |
| G3ILL8 | 110-231 | None |
| A0A674IBA8 | 441-586 | None |
| E2BFL0 | 678-833 | None |
| J9KMG3 | 27-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.