DPCstruct | MC29640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 240 |
|---|---|
| Mean domain length (aa) | 231 ± 62 aa |
| Standard deviation of domain lengths | 61.77 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.10 |
| Pfam Score | 82.81 |
| Assigned Pfam label(s) | PF05649- CL0126- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0X6H2 | 79-296 | RDAKRFDPKPVAQAKVMYRSCLGSVIPVALVQYPFYYRGLEALNYGAIGTVLGHELTHGFDSNGRFFDKFGNMRTWWSAQTHREYET… |
| A0A7R9R145 | 4-186 | AVVNAAYEPTQNSITIPAGILRIPYFDSERPAYLNYGAIGLVVGHEMTHGFDDEGSQFDPKGDLINWWTEDIRKRFGDKAQCFIDEY… |
| A0A3M9YJV3 | 24-171 | None |
| A0A818DPG5 | 104-342 | None |
| A0A814XG19 | 48-312 | None |
| A0A0M3HFA0 | 3-135 | None |
| A0A3R6XSP4 | 399-624 | None |
| A0A2T7PTX0 | 161-285 | None |
| A0A2A6C3X0 | 22-221 | None |
| A0A7J6ZTZ0 | 421-702 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.