DPCstruct | MC2964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 155 ± 24 aa |
| Standard deviation of domain lengths | 23.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090CYG7 | 171-314 | ISAEEMQFFDYLSRCINFTLFDKSHFFLQIFRGAYVMIEDQGKSYDELKKIGSLKERTSSHVSDAKQFSLTGTCVKECLFSRKQIKK… |
| A0A1V9ZMZ5 | 74-243 | TLFSLVNAMINAEFVPSEGLVDVSIPLHLGTVPIERVVLGTLYTQLLGNRGTVLMELLKGAHVVVENDAGVFYGLLKNISTTTYPRI… |
| A0A3S0VZP6 | 145-302 | None |
| A0A177PY39 | 21-151 | None |
| A0A261D991 | 25-175 | None |
| A0A7W1U0S3 | 128-277 | None |
| A0A815UAX9 | 27-225 | None |
| A0A0U5JDQ8 | 189-346 | None |
| A0A839NC10 | 42-191 | None |
| A0A1M3CH02 | 98-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.