DPCstruct | MC29633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 563 ± 48 aa |
| Standard deviation of domain lengths | 48.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1PJQ0 | 391-896 | PSTSDIDKIQQPVKLILSSTCHHAYTSCKNDPECKNLLEPVLSHCDATTCARNECMEALQHFYKTANHKHSVEIAFCLCRKTDSKKD… |
| B0WU08 | 1-616 | MSFIHFQSTCHLALDACRDDQVCSGALKTVLMHCEQHRCNRNACMDSLQSFYKNIVDDLSLDIAFCLCRKTPNRHDSCMIAQEKLHP… |
| A0A182VS72 | 155-796 | None |
| A0A6J2JAX2 | 191-748 | None |
| A0A158P7T7 | 11-520 | None |
| A0A0V1MQF2 | 429-1007 | None |
| A0A6G0TIR0 | 1-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.