DPCstruct | MC29630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 186 ± 32 aa |
| Standard deviation of domain lengths | 31.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 67.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J6XM72 | 18-206 | IGGLGVGVVAVGTMANADSRPAIEQVLAGDTGTTGVSGAAETPAERPSRRQHLTSALAPLVTDGTLTQAQADKVIAAIESAAPARGR… |
| A0A0R2P6G3 | 3-158 | KRLIAGSAIAALALSLAGATGALADGKFRDGKGVSNILSGLVSNGTLTQAQVDEISKAMQDARGANKAAHEAAKAERIKVITDALGI… |
| A0A3B0CRR7 | 1-201 | None |
| A0A433RKU6 | 4-230 | None |
| A0A366ZSH2 | 8-176 | None |
| A0A2E0RXJ9 | 98-302 | None |
| A0A559KB83 | 28-241 | None |
| A0A1V4VPK3 | 1-182 | None |
| A0A3M1YG16 | 1-243 | None |
| A0A285EC23 | 2-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.