DPCstruct | MC29628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 68 ± 13 aa |
| Standard deviation of domain lengths | 12.93 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 95.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3FBY5 | 79-136 | DFKGACLGLDVRRVVETGITPLINTGIAHREAGIGQVGAGTVRAPLLCFEKVLEALAE |
| A0A6J6WW38 | 12-77 | FGIPVLEFRGAPTGIDVTRVLRTGILPQINTGMAGKVAGTGQVGAGLVTPPMEAFTAAIAGLATRI |
| A0A645HZP5 | 1-53 | None |
| A0A7Z7KRC0 | 96-160 | None |
| A0A376HNG0 | 4-63 | None |
| A0A376W1P5 | 267-358 | None |
| A0A6J4L2D1 | 158-224 | None |
| A0A7V3M6N4 | 2-60 | None |
| A0A2N2C3I3 | 8-66 | None |
| A0A7X7IWT6 | 400-472 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.