DPCstruct | MC29627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 150 ± 17 aa |
| Standard deviation of domain lengths | 17.03 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J6WU42 | 18-148 | LNTGPHTYILRSALHGLDHWVRSGEPPASMPKLETNADLSAFLMDANGNVLGGIRTPFVDVPLAKLSGSGQEADGFCGLFGTTLGLT… |
| A0A349N6C9 | 78-227 | GVTPRDSGCDLPAYSTVPFRDVMNAAFEHMVRWLDDGVAPPIADPIQLARAFPTVEFARDDSGNVLGGIRLAEHAVPTAKNTGLNTG… |
| A0A367AMT4 | 241-396 | None |
| A0A536W2I1 | 442-599 | None |
| A0A829YC61 | 512-654 | None |
| A0A7Z6Y6A8 | 35-185 | None |
| A0A534C4K0 | 161-325 | None |
| A0A0Q4CP58 | 494-655 | None |
| A0A7U1EA56 | 6-177 | None |
| A0A4Q7U082 | 336-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.